Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0687700_circ_g.7 |
| ID in PlantcircBase | osa_circ_035395 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 29215173-29215570 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0687700 |
| Parent gene annotation |
Similar to Transcription factor HBP-1b(C38) (Fragment). (Os07t06 87700-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0687700_circ_g.8 Os07g0687700_circ_g.9 Os07g0687700_circ_g.10 Os07g0687700_circ_g.11 Os07g0687700_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0687700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007449* |
| PMCS | 0.163760322 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29215498-29215175(-) |
| Potential amino acid sequence |
MPFSSADFFLLPHDFEQAAELSADELSEVPALAVQASAYCSLVVAHMPFSSADFFLLPHDFEQA AELSADELSEVPALAVQASAYCSLVVAHMPFSSADFFLLPHDFEQAAELSADELSEVPALAVQA SAYCSLVVAHMPFSSADFFLLPHDFEQAAEL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |