Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0687700_circ_g.8 |
ID in PlantcircBase | osa_circ_035396 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 29215173-29215717 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0687700 |
Parent gene annotation |
Similar to Transcription factor HBP-1b(C38) (Fragment). (Os07t06 87700-01) |
Parent gene strand | + |
Alternative splicing | Os07g0687700_circ_g.7 Os07g0687700_circ_g.9 Os07g0687700_circ_g.10 Os07g0687700_circ_g.11 Os07g0687700_circ_g.12 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0687700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187081437 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29215716-29215198(+) 29215498-29215566(-) |
Potential amino acid sequence |
MTIRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGN DNSAACSKS*(+) MPFSSADFFLLPHDFEQAAELSFPLMAWVWSPELEMKIPC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |