Detailed infomation of each circRNA
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205247836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3078392-3078348(-) |
| Potential amino acid sequence |
MDLLPFFHLLILLPHPFQTDYALLQSGFSLNPNPFEMDLLPFFHLLILLPHPFQTDYALLQSGF SLNPNPFEMDLLPFFHLLILLPHPFQTDYALLQSGFSLNPNPFEMDLLPFFHLLILLPH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |