Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0270100_circ_g.9 |
| ID in PlantcircBase | osa_circ_023242 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 11280565-11280894 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0270100 |
| Parent gene annotation |
Similar to GTP-binding protein. (Os04t0270100-01);Similar to GTP -binding protein. (Os04t0270100-02);Similar to G1 to S phase tra nsition protein 1 homolog (GTP-binding protein GST1- HS). (Os04t 0270100-03) |
| Parent gene strand | + |
| Alternative splicing | Os04g0270100_circ_g.8 Os04g0270100_circ_g.10 Os04g0270100_circ_g.11 Os04g0270100_circ_g.12 Os04g0270100_circ_g.13 Os04g0270100_circ_g.14 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0270100-03:2 Os04t0270100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.29446904 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11280686-11280584(+) 11280833-11280584(+) 11280632-11280888(-) |
| Potential amino acid sequence |
MDEPTVKWSKERYDEIESKMVPFLRSSGYNVKKGYICPKR*(+) MMKLSQRWFLFSDLQGTMSKKVISARKGEFETGYEKGGQTREHVLLAKTLGVAKLIVVINKMDE PTVKWSKERYDEIESKMVPFLRSSGYNVKKGYICPKR*(+) MFTSLSSFFVTSFKFTFSGRYNLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |