Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0209300_circ_g.7 |
| ID in PlantcircBase | osa_circ_030161 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 5579539-5579937 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0209300 |
| Parent gene annotation |
Hypothetical conserved gene. (Os06t0209300-01);Conserved hypothe tical protein. (Os06t0209300-02);Hypothetical conserved gene. (O s06t0209300-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0209300_circ_g.6 Os06g0209300_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0209300-01:2 Os06t0209300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109022556 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5579907-5579569(+) 5579836-5579588(+) 5579570-5579865(-) |
| Potential amino acid sequence |
MDEHNIGNHPGISLLCTTNII*(+) MTMYWMLVLLKNMVPQNPQLSLYEWMNITSGTILAYLCFAPPTSSSSLDCK*(+) MMLVVQSRDMPGWFPMLCSSIHREKVADFVGPYF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |