Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0209300_circ_g.6 |
| ID in PlantcircBase | osa_circ_030160 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 5578705-5579748 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0209300 |
| Parent gene annotation |
Hypothetical conserved gene. (Os06t0209300-01);Conserved hypothe tical protein. (Os06t0209300-02);Hypothetical conserved gene. (O s06t0209300-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0209300_circ_g.7 Os06g0209300_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0209300-02:4 Os06t0209300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12992603 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5579677-5578817(+) 5579570-5579685(-) |
| Potential amino acid sequence |
MSASCSSFVDELPAIRSCGSQVDCSCSWSRQISGSVQSQIACRYHREEHFSWKTLPDQNCQY*( +) MMLVVQSRDMSYLYFAEDLVLKIVQSLSHDLDSFNKRKWDHIIANQFLRDLREAKKRGNTERRH KEAQAIMAAAARCILPTSRNAPVRKVAECDVLSAKQESVPVAVPAKQEVHSPKQESIPKFNTGS SRVSQLISVQQANDSSPNSKVSADANIGSFDLAKFSKKNALPCDICMRSETVLNRIFVCSSCKS NQPVIHMIELLVARQQNLNS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |