Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0332400_circ_g.1 |
ID in PlantcircBase | osa_circ_030728 |
Alias | Os_ciR10339 |
Organism | Oryza sativa |
Position | chr6: 13165737-13166457 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0332400 |
Parent gene annotation |
VHS domain containing protein. (Os06t0332400-01);VHS domain cont aining protein. (Os06t0332400-02) |
Parent gene strand | + |
Alternative splicing | Os06g0332400_circ_g.2 Os06g0332400_circ_g.3 Os06g0332400_circ_g.4 Os06g0332400_circ_g.5 |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0332450-00:2 Os06t0332400-02:3 Os06t0332450-00:2 Os06t0332400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.340067453 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13165780-13165749(+) 13165920-13166409(-) |
Potential amino acid sequence |
MHVAERDILHEMVKIAKKKPDYHVKEKILILIDTWQEAFGGSRARYPQYYVAYQELLRAGAVFP QRPDSSVPIYTPPQTQPLRNLPPALRNTERQQEAPESSSTPEVPTLSCWRH*(+) MIIRLFLSYLHHFMEYIPLSNVHMNKVSTIFNQCLQQLSVGTSGVEEDSGASC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |