Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0332400_circ_g.1 |
| ID in PlantcircBase | osa_circ_030728 |
| Alias | Os_ciR10339 |
| Organism | Oryza sativa |
| Position | chr6: 13165737-13166457 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0332400 |
| Parent gene annotation |
VHS domain containing protein. (Os06t0332400-01);VHS domain cont aining protein. (Os06t0332400-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0332400_circ_g.2 Os06g0332400_circ_g.3 Os06g0332400_circ_g.4 Os06g0332400_circ_g.5 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0332450-00:2 Os06t0332400-02:3 Os06t0332450-00:2 Os06t0332400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.340067453 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13165780-13165749(+) 13165920-13166409(-) |
| Potential amino acid sequence |
MHVAERDILHEMVKIAKKKPDYHVKEKILILIDTWQEAFGGSRARYPQYYVAYQELLRAGAVFP QRPDSSVPIYTPPQTQPLRNLPPALRNTERQQEAPESSSTPEVPTLSCWRH*(+) MIIRLFLSYLHHFMEYIPLSNVHMNKVSTIFNQCLQQLSVGTSGVEEDSGASC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |