Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0332400_circ_g.4 |
| ID in PlantcircBase | osa_circ_030731 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 13166297-13168945 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0332400 |
| Parent gene annotation |
VHS domain containing protein. (Os06t0332400-01);VHS domain cont aining protein. (Os06t0332400-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0332400_circ_g.1 Os06g0332400_circ_g.2 Os06g0332400_circ_g.3 Os06g0332400_circ_g.5 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0332450-00:2 Os06t0332400-01:4 Os06t0332450-00:2 Os06t0332400-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016146 |
| PMCS | 0.205453152 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13166981-13166453(+) |
| Potential amino acid sequence |
MDVLSEMLNAIDPGNREGLRQEVIVDLVDQCRSYKQRVVQLVNSTTDEELLSQGLSLNDDLQRV LAKHDAIAAGIAVRVEKPKSVQARGDKSPSIKPEGAKQPDQSALELYFLKDQTALCQSILLHRL NLYGIFLQLCVILSVNKKHLNLLQHQKYLH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |