Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0332400_circ_g.4 |
ID in PlantcircBase | osa_circ_030731 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 13166297-13168945 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0332400 |
Parent gene annotation |
VHS domain containing protein. (Os06t0332400-01);VHS domain cont aining protein. (Os06t0332400-02) |
Parent gene strand | + |
Alternative splicing | Os06g0332400_circ_g.1 Os06g0332400_circ_g.2 Os06g0332400_circ_g.3 Os06g0332400_circ_g.5 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0332450-00:2 Os06t0332400-01:4 Os06t0332450-00:2 Os06t0332400-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016146 |
PMCS | 0.205453152 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13166981-13166453(+) |
Potential amino acid sequence |
MDVLSEMLNAIDPGNREGLRQEVIVDLVDQCRSYKQRVVQLVNSTTDEELLSQGLSLNDDLQRV LAKHDAIAAGIAVRVEKPKSVQARGDKSPSIKPEGAKQPDQSALELYFLKDQTALCQSILLHRL NLYGIFLQLCVILSVNKKHLNLLQHQKYLH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |