Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0271000_circ_g.1 |
ID in PlantcircBase | osa_circ_023249 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 11317806-11321776 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | Os04g0271000 |
Parent gene annotation |
NAD+-dependent histone deacetylase, Seed development (Os04t02710 00-01);Similar to SIR2-like protein. (Os04t0271000-02) |
Parent gene strand | - |
Alternative splicing | Os04g0271000_circ_g.2 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0271000-02:6 Os04t0271000-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.094134685 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11317857-11319735(-) 11319778-11321755(-) |
Potential amino acid sequence |
MVAAVRALPLNGLLIFCLQITPACNMPLLSLKNGGRVAIVNLQATPKDKKASLVIHGLVDKVGH CWGYVYDESAYPSIYSY*(-) MYMMNLRIPPYIRTDFVQISLRNSVKKKCVRWTLRVTSIHGLRAPLPFLRSVEVSFPERPDMKP VVLKEQPFSLQRETSMNRPFVMLLTFNFSDGCGCSSSSIEWPVDFLSADYSCL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |