Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0386800_circ_g.3 |
| ID in PlantcircBase | osa_circ_036946 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 18253744-18255706 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0386800 |
| Parent gene annotation |
Adenine nucleotide translocator 1 domain containing protein. (Os 08t0386800-01);Adenine nucleotide translocator 1 domain containi ng protein. (Os08t0386800-02);Hypothetical conserved gene. (Os08 t0386800-03) |
| Parent gene strand | + |
| Alternative splicing | Os08g0386800_circ_g.1 Os08g0386800_circ_g.2 Os08g0386800_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0386800-02:7 Os08t0386800-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007723* |
| PMCS | 0.12648903 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18254678-18253855(+) 18253792-18255441(-) |
| Potential amino acid sequence |
MQAYKEFRPGVKPPGMWKTLLGVVSPLASSTQNAQNYRALWTGVGAQLARDVPFSAICWSTLEP IRRKLLGIVGEEGDAASVLGANFAAGFVAGSLAAGATCPLDVAKTRRQIEKDTQKAMRMTTRQT LADIWRYYLISDVRRHAHVVSFWEVSLFAHLTAFSTREHLMYS*(+) MTPRVHDGEHLKSDNISKYQLMFALWSFSLPFAYPSLFVSLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |