Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0386800_circ_g.3 |
ID in PlantcircBase | osa_circ_036946 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 18253744-18255706 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0386800 |
Parent gene annotation |
Adenine nucleotide translocator 1 domain containing protein. (Os 08t0386800-01);Adenine nucleotide translocator 1 domain containi ng protein. (Os08t0386800-02);Hypothetical conserved gene. (Os08 t0386800-03) |
Parent gene strand | + |
Alternative splicing | Os08g0386800_circ_g.1 Os08g0386800_circ_g.2 Os08g0386800_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0386800-02:7 Os08t0386800-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007723* |
PMCS | 0.12648903 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18254678-18253855(+) 18253792-18255441(-) |
Potential amino acid sequence |
MQAYKEFRPGVKPPGMWKTLLGVVSPLASSTQNAQNYRALWTGVGAQLARDVPFSAICWSTLEP IRRKLLGIVGEEGDAASVLGANFAAGFVAGSLAAGATCPLDVAKTRRQIEKDTQKAMRMTTRQT LADIWRYYLISDVRRHAHVVSFWEVSLFAHLTAFSTREHLMYS*(+) MTPRVHDGEHLKSDNISKYQLMFALWSFSLPFAYPSLFVSLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |