Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0829600_circ_g.1 |
| ID in PlantcircBase | osa_circ_017353 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35665411-35665993 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0829600 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os02 t0829600-01);Similar to Sperm protamine P1 (Po1) [Contains: Sper m protamine P2 (Po2) (Main protamine)]. (Os02t0829600-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0829500_circ_ag.1 Os02g0829500_circ_ag.2 Os02g0829500_circ_ag.3 Os02g0829500_circ_ag.4 Os02g0829500_circ_ag.5 Os02g0829500_circ_ag.6 Os02g0829500_circ_ag.7 Os02g0829600_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0829600-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.367077171 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35665899-35665592(+) 35665936-35665414(+) 35665595-35665970(-) |
| Potential amino acid sequence |
MARGMDKFEISSNVPRTIASKFPLNIYGSTLYQVKTTRSLTSTIFSCCPVASSLVACCT*(+) MFQGPLPVSFRSTSTVARSTR*(+) MYSRQPVSLQLDSMRKLLKLDFEWFLPGRACYRRC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |