Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0829600_circ_g.1 |
ID in PlantcircBase | osa_circ_017353 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35665411-35665993 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0829600 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os02 t0829600-01);Similar to Sperm protamine P1 (Po1) [Contains: Sper m protamine P2 (Po2) (Main protamine)]. (Os02t0829600-02) |
Parent gene strand | - |
Alternative splicing | Os02g0829500_circ_ag.1 Os02g0829500_circ_ag.2 Os02g0829500_circ_ag.3 Os02g0829500_circ_ag.4 Os02g0829500_circ_ag.5 Os02g0829500_circ_ag.6 Os02g0829500_circ_ag.7 Os02g0829600_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0829600-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.367077171 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35665899-35665592(+) 35665936-35665414(+) 35665595-35665970(-) |
Potential amino acid sequence |
MARGMDKFEISSNVPRTIASKFPLNIYGSTLYQVKTTRSLTSTIFSCCPVASSLVACCT*(+) MFQGPLPVSFRSTSTVARSTR*(+) MYSRQPVSLQLDSMRKLLKLDFEWFLPGRACYRRC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |