Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0797500_circ_g.4 |
| ID in PlantcircBase | osa_circ_016949 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33943787-33944732 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0797500 |
| Parent gene annotation |
Similar to Plastidic aspartate aminotransferase. (Os02t0797500-0 1);Similar to Plastidic aspartate aminotransferase. (Os02t079750 0-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0797500_circ_g.2 Os02g0797500_circ_g.3 Os02g0797500_circ_g.5 |
| Support reads | 40 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0797500-02:4 Os02t0797500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350027828 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33944093-33943874(+) 33944700-33943860(+) |
| Potential amino acid sequence |
MIADIQAAPDGSFVLLHGCAHNPTGIDPTPEQWEKIADVIQEKKHMPFFDVAYQGFASGSLDED ASSVRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVVCSTPEVANRLLLFSLSQEPGRCALLQH LYKDISLKQKY*(+) MLSAQHLKSQTGCYSSVSLRNRVAAPCCSIYTKIFP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |