Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0197950_circ_g.3 |
| ID in PlantcircBase | osa_circ_013665 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5484478-5488499 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0197950 |
| Parent gene annotation |
Hypothetical protein. (Os02t0197950-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0197950_circ_g.1 Os02g0197950_circ_g.2 Os02g0197950_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0197900-01:12 Os02t0197900-02:10 Os02t0197950-00:11 Os02t0197900-01:12 Os02t0197900-02:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11792379 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5485291-5484486(+) |
| Potential amino acid sequence |
MGAVTSLLYGAEDSSIAGMVLDSAFTNLYGLMMELVDVYKIRVPKFTVKMAVQYMRKIIQKRAK FDIMDLNVLQFAPKTFIPALFGHASNDMFIQPHHCDRIHQAYGGDKSIIKFEGDHNSPRPQSYY DSVSMFFYNTLHPPQLPVKCSNNLGAFKVGTVTNESFIFEIISGLRGAGTNSCSSSIDASKFPN ATTPVVELLSESVNQLSIKNDSDLDFLLDENRTLSEIDGDSAGSRLQDKSSGHNEESCSCTSSN RESWGRCSSLGGASDDSFPGDISDKQEVRV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |