Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0197950_circ_g.1 | 
| ID in PlantcircBase | osa_circ_013663 | 
| Alias | Os_ciR8318 | 
| Organism | Oryza sativa | 
| Position | chr2: 5484478-5485720 JBrowse» | 
| Reference genome | IRGSP-1.0.38 | 
| Type | ui-circRNA | 
| Identification method | CIRCexplorer, find_circ | 
| Parent gene | Os02g0197950 | 
| Parent gene annotation | 
							Hypothetical protein. (Os02t0197950-00) | 
					
| Parent gene strand | - | 
| Alternative splicing | Os02g0197950_circ_g.2 Os02g0197950_circ_g.3 Os02g0197950_circ_g.4 | 
| Support reads | 2/1 | 
| Tissues | root/root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | GT-AG | 
| Number of exons covered | Os02t0197900-01:5 Os02t0197900-02:3 Os02t0197900-01:5 Os02t0197950-00:5 Os02t0197900-02:3  | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_008647 zma_circ_002037 | 
| PMCS | 0.189563496 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							5485291-5484486(+) 5485690-5485670(+)  | 
					
| Potential amino acid sequence | 
							MGAVTSLLYGAEDSSIAGMVLDSAFTNLYGLMMELVDVYKIRVPKFTVRV*(+) MSTKSGFLNSRSEYNPDQYLWETEFILAGRKYKRLDLELTNARGLTIKCSHYVPAFIPENTSLP CVIYCHGNSGCRADANEAAVILLPANITVFTLDFSGSGLSGGDYVSLGWHEAFGGDRWVLLQAY SMEQKIPRLLEWYWIVLSLTYMA*(+)  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |