Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0896800_circ_g.1 |
ID in PlantcircBase | osa_circ_005222 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 38975169-38975285 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0896800 |
Parent gene annotation |
Ribosomal protein L18/L5 domain containing protein. (Os01t089680 0-01) |
Parent gene strand | + |
Alternative splicing | Os01g0896700_circ_ag.1 Os01g0896700_circ_ag.2 Os01g0896700_circ_ag.3 Os01g0896700_circ_g.1 Os01g0896700_circ_ag.2 Os01g0896700_circ_ag.3 Os01g0896700_circ_ag.4 Os01g0896700_circ_ag.5 Os01g0896700_circ_ag.6 Os01g0896700_circ_ag.7 |
Support reads | 3 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0896800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.653988523 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38975189-38975282(+) |
Potential amino acid sequence |
MLNQLMKGGLSVLSWMLASLGQPLETVSLVPSRPLGRTTMLNQLMKGGLSVLSWMLASLGQPLE TVSLVPSRPLGRTTMLNQLMKGGLSVLSWMLASLGQPLETVSLVPSRPLGRTTMLNQLMKGGLS VLSWMLASLGQPLETVSLVPS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |