Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0896800_circ_g.1 |
| ID in PlantcircBase | osa_circ_005222 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 38975169-38975285 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0896800 |
| Parent gene annotation |
Ribosomal protein L18/L5 domain containing protein. (Os01t089680 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0896700_circ_ag.1 Os01g0896700_circ_ag.2 Os01g0896700_circ_ag.3 Os01g0896700_circ_g.1 Os01g0896700_circ_ag.2 Os01g0896700_circ_ag.3 Os01g0896700_circ_ag.4 Os01g0896700_circ_ag.5 Os01g0896700_circ_ag.6 Os01g0896700_circ_ag.7 |
| Support reads | 3 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0896800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.653988523 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38975189-38975282(+) |
| Potential amino acid sequence |
MLNQLMKGGLSVLSWMLASLGQPLETVSLVPSRPLGRTTMLNQLMKGGLSVLSWMLASLGQPLE TVSLVPSRPLGRTTMLNQLMKGGLSVLSWMLASLGQPLETVSLVPSRPLGRTTMLNQLMKGGLS VLSWMLASLGQPLETVSLVPS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |