Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0358700_circ_g.7 |
| ID in PlantcircBase | osa_circ_027590 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 17058215-17060554 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0358700 |
| Parent gene annotation |
Similar to predicted protein. (Os05t0358700-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0358700_circ_g.6 Os05g0358700_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0358700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006188* osi_circ_015368 |
| PMCS | 0.234530093 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17058837-17059064(-) |
| Potential amino acid sequence |
MQEYLNHFLGNLDIVNSPEVCKFLEVSCLSFLPEYGPKLKEDYVSVGHLPKIQKDHKENCCSCG LFSCCKSSWQKVWVVLKPGFLALLKDPFDPKLLDVLIFDALPHMDISGEGQISLAKEIKERNPL HFGLQFRWRLYKKASQVLYLHFALKRREFLEEFHEKQEQVKEWLQNLGIGEHMPVGHDEDEADD VNVPAQAEENSIRHR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |