Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0358700_circ_g.7 |
ID in PlantcircBase | osa_circ_027590 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 17058215-17060554 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0358700 |
Parent gene annotation |
Similar to predicted protein. (Os05t0358700-01) |
Parent gene strand | - |
Alternative splicing | Os05g0358700_circ_g.6 Os05g0358700_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0358700-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006188* osi_circ_015368 |
PMCS | 0.234530093 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17058837-17059064(-) |
Potential amino acid sequence |
MQEYLNHFLGNLDIVNSPEVCKFLEVSCLSFLPEYGPKLKEDYVSVGHLPKIQKDHKENCCSCG LFSCCKSSWQKVWVVLKPGFLALLKDPFDPKLLDVLIFDALPHMDISGEGQISLAKEIKERNPL HFGLQFRWRLYKKASQVLYLHFALKRREFLEEFHEKQEQVKEWLQNLGIGEHMPVGHDEDEADD VNVPAQAEENSIRHR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |