Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0608900_circ_g.1 |
| ID in PlantcircBase | osa_circ_034722 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25046887-25047785 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0608900 |
| Parent gene annotation |
Similar to cDNA clone:001-031-A11, full insert sequence (Fragmen t). (Os07t0608900-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0608800_circ_ag.1 Os07g0608800_circ_ag.2 Os07g0608800_circ_g.3 Os07g0608800_circ_ag.4 Os07g0608800_circ_g.5 Os07g0608800_circ_g.6 Os07g0608900_circ_ag.1 Os07g0608900_circ_ag.2 Os07g0608900_circ_ag.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0608900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214190693 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25047068-25047769(+) 25046943-25047723(-) |
| Potential amino acid sequence |
MGSSEMAFGLYYHLPKRAAGIRYVFIGKPMIQRPSSRIVARGIALDDSQLDDHSESDSSSIGTA AQPSPIRNSPSRSLSFSHLSRLRGRVHTLWEWVLRKWPSDCIIIYQSEQLAFVMYSLGSQ*(+) MVIKLRVIEGNTTCNNSRAGPLNHWLPNEYITNASCSLW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |