Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0138100_circ_g.1 |
| ID in PlantcircBase | osa_circ_017841 |
| Alias | Os_ciR8644 |
| Organism | Oryza sativa |
| Position | chr3: 2104473-2105314 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0138100 |
| Parent gene annotation |
Similar to RNA recognition motif family protein, expressed. (Os0 3t0138100-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0138100_circ_g.2 Os03g0138100_circ_g.3 Os03g0138100_circ_g.4 Os03g0138100_circ_g.5 Os03g0138100_circ_g.6 Os03g0138100_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0138100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013242 |
| PMCS | 0.16159812 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2105311-2104896(+) 2105313-2105045(-) 2104817-2105300(-) |
| Potential amino acid sequence |
MSLHTPHVHLPIFPPAQILRVANTLLGQTHFLAAGLLLVLQVVIWHCQEFHKMGKLH*(+) MEIVSSFGPLAAYRFLFNEYLGGACAFLEYIDHSITSKACAGLNGMKLGGGILTAVNVFPNSTE QAFNEASPFYGIPDSAKSLLEEPTKVLQLKNVFDQEEYLLLSKSELEEILEDVRVECASSWKLL VHLVRWLLTAFFLMNTLVGHVHFLSTLITPLHRRHVLASMG*(-) MCLTKKSICYSQNLSWRKYWKMYVWSVQAHGNC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |