Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0138100_circ_g.1 |
ID in PlantcircBase | osa_circ_017841 |
Alias | Os_ciR8644 |
Organism | Oryza sativa |
Position | chr3: 2104473-2105314 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0138100 |
Parent gene annotation |
Similar to RNA recognition motif family protein, expressed. (Os0 3t0138100-01) |
Parent gene strand | - |
Alternative splicing | Os03g0138100_circ_g.2 Os03g0138100_circ_g.3 Os03g0138100_circ_g.4 Os03g0138100_circ_g.5 Os03g0138100_circ_g.6 Os03g0138100_circ_g.7 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0138100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013242 |
PMCS | 0.16159812 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2105311-2104896(+) 2105313-2105045(-) 2104817-2105300(-) |
Potential amino acid sequence |
MSLHTPHVHLPIFPPAQILRVANTLLGQTHFLAAGLLLVLQVVIWHCQEFHKMGKLH*(+) MEIVSSFGPLAAYRFLFNEYLGGACAFLEYIDHSITSKACAGLNGMKLGGGILTAVNVFPNSTE QAFNEASPFYGIPDSAKSLLEEPTKVLQLKNVFDQEEYLLLSKSELEEILEDVRVECASSWKLL VHLVRWLLTAFFLMNTLVGHVHFLSTLITPLHRRHVLASMG*(-) MCLTKKSICYSQNLSWRKYWKMYVWSVQAHGNC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |