Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0562700_circ_g.1 |
| ID in PlantcircBase | osa_circ_038110 |
| Alias | Os_ciR2323 |
| Organism | Oryza sativa |
| Position | chr8: 28173738-28174013 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0562700 |
| Parent gene annotation |
Similar to peptidase M1 family protein. (Os08t0562700-01);Simila r to predicted protein. (Os08t0562700-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0562700_circ_g.2 Os08g0562700_circ_g.3 Os08g0562700_circ_g.4 Os08g0562700_circ_g.5 Os08g0562700_circ_g.6 Os08g0562700_circ_g.7 Os08g0562700_circ_g.8 Os08g0562700_circ_g.9 Os08g0562700_circ_g.10 Os08g0562700_circ_g.11 Os08g0562700_circ_g.12 Os08g0562700_circ_g.13 Os08g0562700_circ_g.14 Os08g0562700_circ_g.15 Os08g0562700_circ_g.16 |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0562700-02:2 Os08t0562700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.27696256 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28173799-28173740(-) |
| Potential amino acid sequence |
MVSAFSRWRRYDESRQALAKVYSLIGGFCGSPVNFHAKDGSGYKFLGEVVLQLDKINPQVASRM VSAFSRWRRYDESRQALAKVYSLIGGFCGSPVNFHAKDGSGYKFLGEVVLQLDKINPQVASRMV SAFSRWRRYDESRQALAKVYSLIGGFCGSPVNFHAKDGSGYKFLGEVVLQLDKINPQVASRMVS AFSRWRRYDESRQALAK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |