Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0486500_circ_g.4 |
ID in PlantcircBase | osa_circ_033844 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 17910126-17910714 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0486500 |
Parent gene annotation |
RhoGAP domain containing protein. (Os07t0486500-01);RhoGAP domai n containing protein. (Os07t0486500-02) |
Parent gene strand | + |
Alternative splicing | Os07g0486500_circ_g.2 Os07g0486500_circ_g.3 Os07g0486500_circ_g.5 Os07g0486500_circ_g.6 Os07g0486500_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0486500-01:3 Os07t0486500-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.319582074 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17910653-17910194(+) |
Potential amino acid sequence |
MTLEFVTALLLRVSRKSSLNKSLVFPLKPPYNESNLVKLCLWYL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |