Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA036295_circ_g.8 |
| ID in PlantcircBase | osi_circ_003420 |
| Alias | 12:10925438|10926423 |
| Organism | Oryza sativa ssp. indica |
| Position | chr12: 10925438-10926423 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA036295 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA036295_circ_g.1 BGIOSGA036295_circ_g.2 BGIOSGA036295_circ_g.3 BGIOSGA036295_circ_g.4 BGIOSGA036295_circ_g.5 BGIOSGA036295_circ_g.6 BGIOSGA036295_circ_g.7 BGIOSGA036295_circ_g.9 BGIOSGA036295_circ_g.10 BGIOSGA036295_circ_g.11 BGIOSGA036295_circ_g.12 BGIOSGA036295_circ_g.13 BGIOSGA036295_circ_g.14 BGIOSGA036295_circ_g.15 BGIOSGA036295_circ_g.16 BGIOSGA036295_circ_g.17 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA036295-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10925454-10926367(-) |
| Potential amino acid sequence |
MASLQIGAQTSVFTVESGSPSRSSRHKPSILSLTSGGPYLSSTWWTSKETIGTWGGNNFAVQGI LEHLNVTKDISDYLWYTTRVNISDADVAFWSSKGVLPSLTIDKIRDVARVFVNGKLADWCTDFS FYCRIWVSQSFK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |