Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA036295_circ_g.8 |
ID in PlantcircBase | osi_circ_003420 |
Alias | 12:10925438|10926423 |
Organism | Oryza sativa ssp. indica |
Position | chr12: 10925438-10926423 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA036295 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA036295_circ_g.1 BGIOSGA036295_circ_g.2 BGIOSGA036295_circ_g.3 BGIOSGA036295_circ_g.4 BGIOSGA036295_circ_g.5 BGIOSGA036295_circ_g.6 BGIOSGA036295_circ_g.7 BGIOSGA036295_circ_g.9 BGIOSGA036295_circ_g.10 BGIOSGA036295_circ_g.11 BGIOSGA036295_circ_g.12 BGIOSGA036295_circ_g.13 BGIOSGA036295_circ_g.14 BGIOSGA036295_circ_g.15 BGIOSGA036295_circ_g.16 BGIOSGA036295_circ_g.17 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA036295-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10925454-10926367(-) |
Potential amino acid sequence |
MASLQIGAQTSVFTVESGSPSRSSRHKPSILSLTSGGPYLSSTWWTSKETIGTWGGNNFAVQGI LEHLNVTKDISDYLWYTTRVNISDADVAFWSSKGVLPSLTIDKIRDVARVFVNGKLADWCTDFS FYCRIWVSQSFK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |