Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0542000_circ_g.4 |
ID in PlantcircBase | osa_circ_040069 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 21344343-21344971 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0542000 |
Parent gene annotation |
Similar to Ribonuclease P. (Os09t0542000-01) |
Parent gene strand | - |
Alternative splicing | Os09g0542000_circ_g.1 Os09g0542000_circ_g.2 Os09g0542000_circ_g.3 Os09g0542000_circ_g.5 Os09g0542000_circ_g.6 Os09g0542000_circ_g.7 Os09g0542000_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0542000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.138198556 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21344901-21344528(+) 21344948-21344945(-) 21344422-21344968(-) |
Potential amino acid sequence |
MEDVSSSFFERVIVIIDTCLVVSSHVCLCLFPFHDLDHHGLSLGQQVREHLLRSRIQPKA*(+) MITITLSKKELDTSSIGYQSPLPADKVKPLVEYENEEDAPSPAGRGRGRGGQGRGRGRGRGTRD LRQQGMYL*(-) MLPHLLAEGEAVVVKVVEGEEAEAHVT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |