Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0542000_circ_g.6 |
| ID in PlantcircBase | osa_circ_040071 |
| Alias | Os09circ10331/Os_ciR1483, |
| Organism | Oryza sativa |
| Position | chr9: 21344499-21345145 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, find_circ, CIRI-long |
| Parent gene | Os09g0542000 |
| Parent gene annotation |
Similar to Ribonuclease P. (Os09t0542000-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0542000_circ_g.1 Os09g0542000_circ_g.2 Os09g0542000_circ_g.3 Os09g0542000_circ_g.4 Os09g0542000_circ_g.5 Os09g0542000_circ_g.7 Os09g0542000_circ_g.8 |
| Support reads | 2/10/6 |
| Tissues | panicle/root/shoot, root, seed, pistil, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0542000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018722 |
| PMCS | 0.387737275 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21344954-21344528(+) 21344901-21344925(+) 21345090-21345101(-) |
| Potential amino acid sequence |
MPCCLKWEQAFLQWLPHISDISRSSGGVLVETNNSSLLRSRIQPKA*(+) MEDVSSSFFERVIVIIDTCLVVSSGSKPSSSGSHISVISVDPVVVFWWRPTILLFFVLVFNQRL NLISRQRRLISDGGCVQLLL*(+) MWEPLEEGLLPLETTRHVSMITITLSKKELDTSSIGYQSPLPADKVKPLVEYENEEEKNCWSPP KHHHWIY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017; this study |