Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0102700_circ_g.6 |
ID in PlantcircBase | osa_circ_022866 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 193516-193832 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0102700 |
Parent gene annotation |
Similar to N-acylethanolamine amidohydrolase. (Os04t0102700-01) |
Parent gene strand | - |
Alternative splicing | Os04g0102700_circ_g.7 Os04g0102700_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0102700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.291015957 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
193577-193550(+) 193521-193792(-) 193564-193792(-) |
Potential amino acid sequence |
MNNTPHFRKRATQTASFSTERILSKNVVAPFDGYGKQSMSSLMAIKIPSKMEIGFPIVWIVSSY SKA*(+) MGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVLFIGKANMHE LGLGVTGNNPNYGKPNFHLGRDLYRH*(-) MHELGLGVTGNNPNYGKPNFHLGRDLYRH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |