Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0102700_circ_g.6 |
| ID in PlantcircBase | osa_circ_022866 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 193516-193832 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0102700 |
| Parent gene annotation |
Similar to N-acylethanolamine amidohydrolase. (Os04t0102700-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0102700_circ_g.7 Os04g0102700_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0102700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291015957 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
193577-193550(+) 193521-193792(-) 193564-193792(-) |
| Potential amino acid sequence |
MNNTPHFRKRATQTASFSTERILSKNVVAPFDGYGKQSMSSLMAIKIPSKMEIGFPIVWIVSSY SKA*(+) MGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVLFIGKANMHE LGLGVTGNNPNYGKPNFHLGRDLYRH*(-) MHELGLGVTGNNPNYGKPNFHLGRDLYRH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |