Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0553200_circ_g.4 |
ID in PlantcircBase | osa_circ_014992 |
Alias | Os02circ15106 |
Organism | Oryza sativa |
Position | chr2: 20868848-20869679 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os02g0553200 |
Parent gene annotation |
Thylakoid membrane-bound ascorbate peroxidase, Tolerance to bact erial blight, Response to NaCl (Os02t0553200-01) |
Parent gene strand | - |
Alternative splicing | Os02g0553200_circ_g.1 Os02g0553200_circ_g.2 Os02g0553200_circ_g.3 Os02g0553200_circ_g.5 Os02g0553200_circ_g.6 Os02g0553200_circ_g.7 Os02g0553200_circ_g.8 Os02g0553200_circ_g.9 |
Support reads | 2/3 |
Tissues | leaf/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0553200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004001* osi_circ_011862 |
PMCS | 0.244661729 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20869618-20868922(+) 20869644-20869612(+) 20868914-20869609(-) |
Potential amino acid sequence |
MSFSVVFKECLLILCIFFGIYLSVGVFRSDEGLWLRCCTVVVIRWR*(+) MPPDPLHIFRHIPFRRSISQRRRALVAVLHRCCHPLAMMPLLLLPLLVLELVQLPSSPRLVEVV VLLLALVLVQDPSLRRLVHRPVKIPQVDRTLHQGRSV*(+) MTTTVQHRNQSPSSLRNTPTERYMPKNMQRIRRHSLKTTLKLMLN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |