Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA006268_circ_g.3 |
ID in PlantcircBase | osi_circ_004001 |
Alias | 2:22502208|22503038 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 22502208-22503038 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA006268 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA006268_circ_g.1 BGIOSGA006268_circ_g.2 BGIOSGA006268_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA006268-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_014992* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22502274-22502968(-) 22502977-22502282(+) 22503003-22502971(+) |
Potential amino acid sequence |
MTTTVQHRNQSPSSLRNTPTERYMPKNMQRIRRHSLKTTLKLMLN*(-) MSFSVVFKECLLILCIFFGIYLSVGVFRSDEGLWLRCCTVVVIRWR*(+) MPPDPLHIFRHIPFRRSISQRRRALVAVLHRCCHPLAMMPLLLLPLLELELVQLPSSPRLVEVV LLLLALVLVQDPSLRRLVHRPVKIPQVDRTLHQGRSV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |