Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0507800_circ_g.1 |
| ID in PlantcircBase | osa_circ_007602 |
| Alias | Os_ciR1563 |
| Organism | Oryza sativa |
| Position | chr10: 19435104-19436109 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os10g0507800 |
| Parent gene annotation |
Similar to chaperone protein dnaJ 13. (Os10t0507800-01);Similar to Chaperone protein dnaJ 13. (Os10t0507800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 11/3 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0507800-02:3 Os10t0507800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002896* osi_circ_008586 |
| PMCS | 0.24451776 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19435129-19435106(-) |
| Potential amino acid sequence |
MIYNIGIQIQLALGTDSSISVGWQKKDEKNSAAGDVKLGTNYFGASAHYTRYFSTKSHGRVAGR VGSTALDFEIGGGRRISEFSTVRMIYNIGIQIQLALGTDSSISVGWQKKDEKNSAAGDVKLGTN YFGASAHYTRYFSTKSHGRVAGRVGSTALDFEIGGGRRISEFSTVRMIYNIGIQIQLALGTDSS ISVGWQKKDEKNSAAGDVKLGTNYFGASAHYTRYFSTKSHGRVAGRVGSTALDFEIGGGRRISE FSTVRMIYNIGIQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |