Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0507800_circ_g.1 |
ID in PlantcircBase | osa_circ_007602 |
Alias | Os_ciR1563 |
Organism | Oryza sativa |
Position | chr10: 19435104-19436109 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os10g0507800 |
Parent gene annotation |
Similar to chaperone protein dnaJ 13. (Os10t0507800-01);Similar to Chaperone protein dnaJ 13. (Os10t0507800-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 11/3 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0507800-02:3 Os10t0507800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002896* osi_circ_008586 |
PMCS | 0.24451776 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19435129-19435106(-) |
Potential amino acid sequence |
MIYNIGIQIQLALGTDSSISVGWQKKDEKNSAAGDVKLGTNYFGASAHYTRYFSTKSHGRVAGR VGSTALDFEIGGGRRISEFSTVRMIYNIGIQIQLALGTDSSISVGWQKKDEKNSAAGDVKLGTN YFGASAHYTRYFSTKSHGRVAGRVGSTALDFEIGGGRRISEFSTVRMIYNIGIQIQLALGTDSS ISVGWQKKDEKNSAAGDVKLGTNYFGASAHYTRYFSTKSHGRVAGRVGSTALDFEIGGGRRISE FSTVRMIYNIGIQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |