Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0261500_circ_g.2 |
| ID in PlantcircBase | osa_circ_018969 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8502908-8504218 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0261500 |
| Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0261500-01);Similar to dnaJ subfamily C member 8. (Os03t026 1500-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0261500_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0261500-01:4 Os03t0261500-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165861531 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8504143-8502935(+) 8504022-8503126(+) |
| Potential amino acid sequence |
MKRKQKKCGRRSGSMKRSGKRPETNDSGKSTAAPT*(+) MQMRISEEEGRLKKDEEETKEMWKKKREHEEKWEETRDQRLWQKHSSSYLIHRREDIFLIKLLL QKKS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |