Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0261500_circ_g.2 |
ID in PlantcircBase | osa_circ_018969 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8502908-8504218 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0261500 |
Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0261500-01);Similar to dnaJ subfamily C member 8. (Os03t026 1500-02) |
Parent gene strand | + |
Alternative splicing | Os03g0261500_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0261500-01:4 Os03t0261500-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165861531 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8504143-8502935(+) 8504022-8503126(+) |
Potential amino acid sequence |
MKRKQKKCGRRSGSMKRSGKRPETNDSGKSTAAPT*(+) MQMRISEEEGRLKKDEEETKEMWKKKREHEEKWEETRDQRLWQKHSSSYLIHRREDIFLIKLLL QKKS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |