Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0261500_circ_g.1 |
| ID in PlantcircBase | osa_circ_018968 |
| Alias | Os03circ09263 |
| Organism | Oryza sativa |
| Position | chr3: 8502130-8504218 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os03g0261500 |
| Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0261500-01);Similar to dnaJ subfamily C member 8. (Os03t026 1500-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0261500_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf and panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0261500-01:6 Os03t0261500-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004700* |
| PMCS | 0.13799487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8504022-8502168(+) 8504143-8502168(+) |
| Potential amino acid sequence |
MQMRISEEEGRLKKDEEETKEMWKKKREHEEKWEETRDQRDSWLLQVKPFRAS*(+) MKRKQKKCGRRSGSMKRSGKRPETNEILGCFKLNPFEHLKLSFDSSADEVKKQYRKLSLLVHPD KCKHPKAQEAFAALAKAQQLLLDPQERGYILDQVTAAKEELRAKRKKELKKDSASKIKSQVDEG KYEEQYERSEEFQKQLIIKVREILTDKEWRRRKMQMRISEEEGRLKKDEEETKEMWKKKREHEE KWEETRDQRDSWLLQVKPFRAS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |