Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0261500_circ_g.1 |
ID in PlantcircBase | osa_circ_018968 |
Alias | Os03circ09263 |
Organism | Oryza sativa |
Position | chr3: 8502130-8504218 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os03g0261500 |
Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os03t0261500-01);Similar to dnaJ subfamily C member 8. (Os03t026 1500-02) |
Parent gene strand | + |
Alternative splicing | Os03g0261500_circ_g.2 |
Support reads | 2 |
Tissues | leaf and panicle |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0261500-01:6 Os03t0261500-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004700* |
PMCS | 0.13799487 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8504022-8502168(+) 8504143-8502168(+) |
Potential amino acid sequence |
MQMRISEEEGRLKKDEEETKEMWKKKREHEEKWEETRDQRDSWLLQVKPFRAS*(+) MKRKQKKCGRRSGSMKRSGKRPETNEILGCFKLNPFEHLKLSFDSSADEVKKQYRKLSLLVHPD KCKHPKAQEAFAALAKAQQLLLDPQERGYILDQVTAAKEELRAKRKKELKKDSASKIKSQVDEG KYEEQYERSEEFQKQLIIKVREILTDKEWRRRKMQMRISEEEGRLKKDEEETKEMWKKKREHEE KWEETRDQRDSWLLQVKPFRAS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |