Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d052050_circ_g.2 |
| ID in PlantcircBase | zma_circ_008160 |
| Alias | zma_circ_0001601 |
| Organism | Zea mays |
| Position | chr4: 177646013-177646254 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d052050 |
| Parent gene annotation |
Nudix hydrolase 3 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d052050_circ_g.3 Zm00001d052050_circ_g.4 Zm00001d052050_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d052050_T004:2 Zm00001d052050_T005:2 Zm00001d052050_T002:2 Zm00001d052050_T008:2 Zm00001d052050_T001:2 Zm00001d052050_T003:2 Zm00001d052050_T007:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291880716 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
177646089-177646015(-) 177646022-177646038(-) |
| Potential amino acid sequence |
MDNIFKSDSISAAPIRVINLLYNAGATFEAFVGIRDDTATSQVKLFGDQLQDLEKNLPMDNIFK SDSISAAPIRVINLLYNAGATFEAFVGIRDDTATSQVKLFGDQLQDLEKNLPMDNIFKSDSISA APIRVINLLYNAGATFEAFVGIRDDTATSQVKLFGDQLQDLEKNLPMDNIFKSDSISAAPIRVI NLLYNAG(-) MLGQLLKHLSEYVMTQQLLKLNSLVISSRIWRKTFQWTIFSNQIVYLLLLFV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |