Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0659200_circ_g.7 |
| ID in PlantcircBase | osa_circ_040562 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 26815128-26815324 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os01g0659200 |
| Parent gene annotation |
Similar to Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPa se E subunit) (Vacuolar proton pump E subunit). (Os01t0659200-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os01g0659200_circ_g.2 Os01g0659200_circ_g.3 Os01g0659200_circ_g.4 Os01g0659200_circ_g.5 Os01g0659200_circ_g.6 Os01g0659200_circ_g.8 Os01g0659200_circ_g.9 Os01g0659200_circ_g.10 Os01g0659200_circ_g.11 Os01g0659200_circ_g.12 Os01g0659200_circ_g.13 Os01g0659200_circ_g.15 Os01g0659200_circ_g.16 |
| Support reads | NA |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0659200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.209391963 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26815190-26815219(+) 26815210-26815303(-) |
| Potential amino acid sequence |
MWNLYCIQQRMNMRQKQKFITQRYLLTTMCTYRLLQALMIPMRGFGFASVERASGTSPLPQRRP SSCGICTAFSKE*(+) MQYRFHMMMVFFAATEKYRWLFQPKQTQNLSWES*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |