Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0125000_circ_g.2 |
| ID in PlantcircBase | osa_circ_026386 |
| Alias | Os_ciR9786 |
| Organism | Oryza sativa |
| Position | chr5: 1427935-1429601 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0125000 |
| Parent gene annotation |
SUMO (small ubiquitin-related modifier) E3-ligase, Abiotic stres s response, Stress adaptation (Os05t0125000-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0125000_circ_g.1 Os05g0125000_circ_g.3 Os05g0125000_circ_g.4 Os05g0125000_circ_g.5 Os05g0125000_circ_g.6 Os05g0125000_circ_g.7 Os05g0125000_circ_g.8 Os05g0125000_circ_g.9 Os05g0125000_circ_g.10 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0125000-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139009583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1428695-1427956(+) |
| Potential amino acid sequence |
MQIQCAPDLATRSHSGSDFSFRPIEEAYDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHL NCVLIPDKPGESAEVPPVFYCELCRLSRADPFWVTAGNPLLPVKFVSSGVTNDGINWHTLE*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |