Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G351800_circ_g.2 |
| ID in PlantcircBase | gra_circ_000790 |
| Alias | Chr07:58184072|58185740 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 58184072-58185740 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G351800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.007G351800_circ_g.1 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G351800.1:5 Gorai.007G351800.3:5 Gorai.007G351800.4:5 Gorai.007G351800.5:5 Gorai.007G351800.2:5 Gorai.007G351800.6:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.468770142 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
58185724-58185737(-) |
| Potential amino acid sequence |
MTKISPDIDETMLKESIVAVSADVSFASDHFPKYKLGPDNQILEEPRGDNSGPSLKEVVERETT QLSKQHKRLSVRDLASKFDKNLTAAAKFADEAKLREVASLEGHVLLKKLRDALESLRGRMAGRN KEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVNQEKSFACAEIESA RAVVQRFGEALDEQEKNPENSQKTQEVEELVEEVQEARRIKFMHQPSKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |