Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G60410_circ_g.28 |
| ID in PlantcircBase | ath_circ_045009 |
| Alias | At_ciR472 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24297871-24298623 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, circseq_cup, CIRI-full |
| Parent gene | AT5G60410 |
| Parent gene annotation |
DNA-binding protein with MIZ/SP-RING zinc finger, PHD-finger and SAP domain |
| Parent gene strand | + |
| Alternative splicing | AT5G60410_circ_g.1 AT5G60410_circ_g.2 AT5G60410_circ_g.3 AT5G60410_circ_g.4 AT5G60410_circ_g.5 AT5G60410_circ_g.6 AT5G60410_circ_g.7 AT5G60410_circ_g.8 AT5G60410_circ_g.9 AT5G60410_circ_g.10 AT5G60410_circ_g.11 AT5G60410_circ_g.12 AT5G60410_circ_g.13 AT5G60410_circ_g.14 AT5G60410_circ_g.15 AT5G60410_circ_g.16 AT5G60410_circ_g.17 AT5G60410_circ_g.18 AT5G60410_circ_g.19 AT5G60410_circ_g.20 AT5G60410_circ_g.21 AT5G60410_circ_g.22 AT5G60410_circ_g.23 AT5G60410_circ_g.24 AT5G60410_circ_g.25 AT5G60410_circ_g.26 AT5G60410_circ_g.27 AT5G60410_circ_g.29 AT5G60410_circ_g.30 AT5G60410_circ_g.31 |
| Support reads | 11 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G60410.6:2 AT5G60410.3:2 AT5G60410.4:2 AT5G60410.2:2 AT5G60410.5:2 AT5G60410.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.369687161 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24298581-24297873(-) |
| Potential amino acid sequence |
MSLSLSALSSPPPPPMHRRTRARASSKVSPLPSSGIKFRTCCRVLRFTSLTPKQKIRTSPPLKD ILLTPSLIQDVIGHRRLTPKKSATTSMSLSLSALSSPPPPPMHRRTRARASSKVSPLPSSGIKF RTCCRVLRFTSLTPKQKIRTSPPLKDILLTPSLIQDVIGHRRLTPKKSATTSMSLSLSALSSPP PPPMHRRTRARASSKVSPLPSSGIKFRTCCRVLRFTSLTPKQKIRTSPPLKDILLTPSLIQDVI GHRRLTPKKSATTSMSLSLSALSSPPPPPMHRRTRARASSKVSPLPSSGIKFRTCCRVLRFTSL TPKQKIRTSPPLKDILLTPSLIQDV(-) |
| Sponge-miRNAs | ath-miR394a |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |