Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0693500_circ_g.3 |
| ID in PlantcircBase | osa_circ_035451 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 29510258-29510604 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0693500 |
| Parent gene annotation |
Similar to AMP deaminase 2 (EC 3.5.4.6) (AMP deaminase isoform L ). Splice isoform Ex1A-3. (Os07t0693500-01);Hypothetical gene. ( Os07t0693500-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0693500_circ_g.2 Os07g0693500_circ_g.3 Os07g0693500_circ_g.4 Os07g0693500_circ_g.5 Os07g0693500_circ_ag.1 Os07g0693500_circ_g.2 Os07g0693500_circ_g.4 Os07g0693600_circ_g.1 Os07g0693600_circ_g.2 Os07g0693700_circ_g.1 Os07g0693700_circ_g.2 Os07g0693700_circ_g.3 Os07g0693700_circ_g.4 Os07g0693700_circ_g.5 Os07g0693900_circ_g.1 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0693500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.337209678 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29510319-29510601(+) 29510321-29510385(-) |
| Potential amino acid sequence |
MPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGEVVGLDLVDDESKPER RPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGEVVGLDLVDDE SKPERRPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGEVVGLD LVDDESKPERRPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGE (+) MCFVGRLSGLLSSSTKSSPTTSPQCGRSLIVVIPLDSRSLFSVYKLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |