Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0693700_circ_g.4 |
| ID in PlantcircBase | osa_circ_035456 |
| Alias | Os07circ21521 |
| Organism | Oryza sativa |
| Position | chr7: 29529544-29529730 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os07g0693700 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os07t0693700-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0693500_circ_g.2 Os07g0693500_circ_g.3 Os07g0693500_circ_g.4 Os07g0693500_circ_g.5 Os07g0693500_circ_ag.1 Os07g0693500_circ_g.2 Os07g0693500_circ_g.3 Os07g0693500_circ_g.4 Os07g0693600_circ_g.1 Os07g0693600_circ_g.2 Os07g0693700_circ_g.1 Os07g0693700_circ_g.2 Os07g0693700_circ_g.3 Os07g0693700_circ_g.5 Os07g0693900_circ_g.1 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0693700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.243029947 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29529638-29529575(+) 29529715-29529726(-) |
| Potential amino acid sequence |
MSEQLESIFLKESLVEPSIPDPDDPIEELSIDSSRRNSWWHH*(+) MGSSGSGIDGSTSDSFKKIDSNCSLMVCALKLPFCFAFSSLPFNPLMMPPRIPPAGVY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |