Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0693700_circ_g.4 |
ID in PlantcircBase | osa_circ_035456 |
Alias | Os07circ21521 |
Organism | Oryza sativa |
Position | chr7: 29529544-29529730 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os07g0693700 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os07t0693700-01) |
Parent gene strand | + |
Alternative splicing | Os07g0693500_circ_g.2 Os07g0693500_circ_g.3 Os07g0693500_circ_g.4 Os07g0693500_circ_g.5 Os07g0693500_circ_ag.1 Os07g0693500_circ_g.2 Os07g0693500_circ_g.3 Os07g0693500_circ_g.4 Os07g0693600_circ_g.1 Os07g0693600_circ_g.2 Os07g0693700_circ_g.1 Os07g0693700_circ_g.2 Os07g0693700_circ_g.3 Os07g0693700_circ_g.5 Os07g0693900_circ_g.1 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0693700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.243029947 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29529638-29529575(+) 29529715-29529726(-) |
Potential amino acid sequence |
MSEQLESIFLKESLVEPSIPDPDDPIEELSIDSSRRNSWWHH*(+) MGSSGSGIDGSTSDSFKKIDSNCSLMVCALKLPFCFAFSSLPFNPLMMPPRIPPAGVY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |