Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0819900_circ_g.14 |
ID in PlantcircBase | osa_circ_004643 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 34957079-34957868 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0819900 |
Parent gene annotation |
Armadillo-like helical domain containing protein. (Os01t0819900- 01);Similar to HEAT repeat-containing protein. (Os01t0819900-02) |
Parent gene strand | - |
Alternative splicing | Os01g0819900_circ_g.4 Os01g0819900_circ_g.5 Os01g0819900_circ_g.6 Os01g0819900_circ_g.7 Os01g0819900_circ_g.8 Os01g0819900_circ_g.9 Os01g0819900_circ_g.10 Os01g0819900_circ_g.11 Os01g0819900_circ_g.12 Os01g0819900_circ_g.13 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0819900-01:2 Os01t0819900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010882 |
PMCS | 0.255678333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34957166-34957163(-) |
Potential amino acid sequence |
MKHTIYIVTEPVTPLSEKLKELNLGGTQRMMGRPCQSFLCQGAILRTGTWLLVGMVLRDYEQCV IQTFYPFFTVLKQKFLMDLP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |