Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0819900_circ_g.10 |
| ID in PlantcircBase | osa_circ_004639 |
| Alias | Os_ciR6225 |
| Organism | Oryza sativa |
| Position | chr1: 34954703-34955787 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0819900 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os01t0819900- 01);Similar to HEAT repeat-containing protein. (Os01t0819900-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0819900_circ_g.4 Os01g0819900_circ_g.5 Os01g0819900_circ_g.6 Os01g0819900_circ_g.7 Os01g0819900_circ_g.8 Os01g0819900_circ_g.9 Os01g0819900_circ_g.11 Os01g0819900_circ_g.12 Os01g0819900_circ_g.13 Os01g0819900_circ_g.14 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0819900-02:3 Os01t0819900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002496* osi_circ_010879 |
| PMCS | 0.125831498 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34955753-34955782(-) |
| Potential amino acid sequence |
MELTKSDWVSIRKSPPWAIDSWGLGCLIYELFSGAKLTRTEDLRNTASIPKSLLPDYQRLLSSA PSRRMNPSKLIDNSAI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |