Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0455500_circ_g.4 |
| ID in PlantcircBase | osa_circ_028124 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 22375522-22376918 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0455500 |
| Parent gene annotation |
Similar to Delta-1-pyrroline-5-carboxylate synthetase. (Os05t045 5500-01);Similar to Delta 1-pyrroline-5-carboxylate synthetase ( P5CS). (Os05t0455500-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0455500_circ_g.1 Os05g0455500_circ_g.2 Os05g0455500_circ_g.3 Os05g0455500_circ_g.5 Os05g0455500_circ_g.6 Os05g0455500_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0455500-02:4 Os05t0455500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161642496 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22376894-22375588(+) 22376679-22376655(-) 22375662-22376916(-) |
| Potential amino acid sequence |
MTRSMTSSSFHNDEYGQLLIEHHQQTQQCRP*(+) MDMAKHIVMDAKIDYPAACNAMETLLVHKDLMKSPGLDDILVALKTEGVNIYGGPIAHKALGFP KAVSFHHEYSSMACTVEFVDDVQSAIDHIHRYGSLMMSLILSFQEEVISLSLKSRRQLRFLFLG MLMVYATYILTNQLTWIWQNIL*(-) MVDLLRTKLWDFQKLFHFIMSIVLWPALLSLLMMFNQQLTIFIVMEA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |