Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_10G173000_circ_g.1 |
| ID in PlantcircBase | gma_circ_008820 |
| Alias | circRNA438 |
| Organism | Glycine max |
| Position | chr10: 40690146-40690420 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_10G173000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_10G173000_circ_g.2 |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH34261:1 KRH34260:1 KRH34263:1 KRH34259:1 KRH34262:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236554788 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40690366-40690221(+) 40690239-40690320(-) |
| Potential amino acid sequence |
MPGLVLGHSSSERGRTFERAQLIPSLLWTKRIQITCNKMSSHHK*(+) MSLLPTCDVNSSCCKLFEFFLSTINWESVVPFQMYALFQMKNGQALSLASGVHFGFYQVSLIEF *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |