Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0175500_circ_g.9 |
ID in PlantcircBase | osa_circ_029864 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 3802403-3802917 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0175500 |
Parent gene annotation |
Epsin-like, N-terminal domain containing protein. (Os06t0175500- 01);Similar to predicted protein. (Os06t0175500-02) |
Parent gene strand | - |
Alternative splicing | Os06g0175500_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0175500-01:3 Os06t0175500-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006555* |
PMCS | 0.158091294 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3802628-3802484(+) 3802867-3802419(+) 3802514-3802805(-) |
Potential amino acid sequence |
MARAKAFFSSISAAAGFGSFRPSKSVGSSLGASSFTGSGSGSGSCSGSGSGAGGGDAGFSSSSA SFLYSIASTSFLLEVIAVSFELGVVTRASSQPVTPF*(+) MPAFLPPLPLSCIRLPVPASCLK*(+) MMYLKLHLLKMESLAGSWPLSPHPAQTKLLLLQARSWYWQSNTRKRQRRKKSRHRLLPLQSQNQ NKNQSQSLNQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |