Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0175500_circ_g.9 |
| ID in PlantcircBase | osa_circ_029864 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 3802403-3802917 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0175500 |
| Parent gene annotation |
Epsin-like, N-terminal domain containing protein. (Os06t0175500- 01);Similar to predicted protein. (Os06t0175500-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0175500_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0175500-01:3 Os06t0175500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006555* |
| PMCS | 0.158091294 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3802628-3802484(+) 3802867-3802419(+) 3802514-3802805(-) |
| Potential amino acid sequence |
MARAKAFFSSISAAAGFGSFRPSKSVGSSLGASSFTGSGSGSGSCSGSGSGAGGGDAGFSSSSA SFLYSIASTSFLLEVIAVSFELGVVTRASSQPVTPF*(+) MPAFLPPLPLSCIRLPVPASCLK*(+) MMYLKLHLLKMESLAGSWPLSPHPAQTKLLLLQARSWYWQSNTRKRQRRKKSRHRLLPLQSQNQ NKNQSQSLNQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |