Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0777100_circ_g.2 |
| ID in PlantcircBase | osa_circ_016747 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32861676-32862166 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0777100 |
| Parent gene annotation |
DENN domain containing protein. (Os02t0777100-01);Hypothetical c onserved gene. (Os02t0777100-02);Similar to predicted protein. ( Os02t0777100-03);Similar to predicted protein. (Os02t0777100-04) |
| Parent gene strand | - |
| Alternative splicing | Os02g0777100_circ_g.1 Os02g0777100_circ_g.3 Os02g0777100_circ_g.4 Os02g0777100_circ_g.5 Os02g0777100_circ_g.6 Os02g0777100_circ_g.7 Os02g0777100_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0777100-01:2 Os02t0777100-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230054481 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32862135-32861714(+) 32862146-32861800(+) 32861697-32862126(-) 32861693-32862107(-) |
| Potential amino acid sequence |
MYIGCLVLHTNLGICTFINGPLSC*(+) MSCSAHQPGHLYIHKRASFLLENSLPLVWNGMDAGQKATPSAAGVAGQK*(+) MNVQMPRLVCRTRHPMYIPG*(-) MYRCPGWCAEQDIRCTFQASERRGY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |