Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0777100_circ_g.2 |
ID in PlantcircBase | osa_circ_016747 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 32861676-32862166 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0777100 |
Parent gene annotation |
DENN domain containing protein. (Os02t0777100-01);Hypothetical c onserved gene. (Os02t0777100-02);Similar to predicted protein. ( Os02t0777100-03);Similar to predicted protein. (Os02t0777100-04) |
Parent gene strand | - |
Alternative splicing | Os02g0777100_circ_g.1 Os02g0777100_circ_g.3 Os02g0777100_circ_g.4 Os02g0777100_circ_g.5 Os02g0777100_circ_g.6 Os02g0777100_circ_g.7 Os02g0777100_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0777100-01:2 Os02t0777100-04:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230054481 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32862135-32861714(+) 32862146-32861800(+) 32861697-32862126(-) 32861693-32862107(-) |
Potential amino acid sequence |
MYIGCLVLHTNLGICTFINGPLSC*(+) MSCSAHQPGHLYIHKRASFLLENSLPLVWNGMDAGQKATPSAAGVAGQK*(+) MNVQMPRLVCRTRHPMYIPG*(-) MYRCPGWCAEQDIRCTFQASERRGY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |