Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0338100_circ_g.4 |
ID in PlantcircBase | osa_circ_023445 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 15926974-15927305 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0338100 |
Parent gene annotation |
Similar to IN2-2 protein. (Os04t0338100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0338100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005386* |
PMCS | 0.479811822 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15927168-15926978(+) |
Potential amino acid sequence |
MPHFNYFSYFHFRELGIGIVAYSPLGRGFFSGGAKLVESICSGCSQDW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |