Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0338100_circ_g.4 |
| ID in PlantcircBase | osa_circ_023445 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 15926974-15927305 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0338100 |
| Parent gene annotation |
Similar to IN2-2 protein. (Os04t0338100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0338100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005386* |
| PMCS | 0.479811822 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15927168-15926978(+) |
| Potential amino acid sequence |
MPHFNYFSYFHFRELGIGIVAYSPLGRGFFSGGAKLVESICSGCSQDW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |