Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0297500_circ_g.9 |
| ID in PlantcircBase | osa_circ_011260 |
| Alias | Os_ciR7297 |
| Organism | Oryza sativa |
| Position | chr12: 11736835-11737572 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0297500 |
| Parent gene annotation |
Pyruvate phosphate dikinase, PEP/pyruvate-binding domain contain ing protein. (Os12t0297500-01);Similar to Phosphoglucan, water d ikinase, chloroplastic. (Os12t0297500-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0297500_circ_g.4 Os12g0297500_circ_g.5 Os12g0297500_circ_g.6 Os12g0297500_circ_g.7 Os12g0297500_circ_g.8 Os12g0297500_circ_g.10 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0297500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374481707 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11737076-11736837(-) |
| Potential amino acid sequence |
MTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLSSLFEQLESIKE SLNESGLEVLSSFVETKRSLDQVDHAEDLDKNDTIQILMTTLQSLSSLRSVLMKGLESGLRNDA PDNAIAMRQKWRLCEISLEDYSFVLLSSLFEQLESIKESLNESGLEVLSSFVETKRSLDQVDHA EDLDKNDTIQILMTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLL SSLFEQLESIKESLNESGLEVLSSFVETKRSLDQVDHAEDLDKNDTIQILMTTLQSLSSLRSVL MKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |