Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0297500_circ_g.9 |
ID in PlantcircBase | osa_circ_011260 |
Alias | Os_ciR7297 |
Organism | Oryza sativa |
Position | chr12: 11736835-11737572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os12g0297500 |
Parent gene annotation |
Pyruvate phosphate dikinase, PEP/pyruvate-binding domain contain ing protein. (Os12t0297500-01);Similar to Phosphoglucan, water d ikinase, chloroplastic. (Os12t0297500-02) |
Parent gene strand | - |
Alternative splicing | Os12g0297500_circ_g.4 Os12g0297500_circ_g.5 Os12g0297500_circ_g.6 Os12g0297500_circ_g.7 Os12g0297500_circ_g.8 Os12g0297500_circ_g.10 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0297500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.374481707 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11737076-11736837(-) |
Potential amino acid sequence |
MTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLSSLFEQLESIKE SLNESGLEVLSSFVETKRSLDQVDHAEDLDKNDTIQILMTTLQSLSSLRSVLMKGLESGLRNDA PDNAIAMRQKWRLCEISLEDYSFVLLSSLFEQLESIKESLNESGLEVLSSFVETKRSLDQVDHA EDLDKNDTIQILMTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLL SSLFEQLESIKESLNESGLEVLSSFVETKRSLDQVDHAEDLDKNDTIQILMTTLQSLSSLRSVL MKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |