Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0248900_circ_g.4 |
ID in PlantcircBase | osa_circ_038544 |
Alias | Os_ciR1838 |
Organism | Oryza sativa |
Position | chr9: 3726364-3728751 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os09g0248900 |
Parent gene annotation |
Myb/SANT-like domain domain containing protein. (Os09t0248900-01 ) |
Parent gene strand | - |
Alternative splicing | Os09g0248900_circ_g.1 Os09g0248900_circ_g.2 Os09g0248900_circ_g.3 Os09g0248900_circ_g.5 Os09g0248900_circ_g.6 |
Support reads | 7 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0248900-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.10816607 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3728459-3726580(+) 3728715-3728637(-) |
Potential amino acid sequence |
MAFHIKESSLPTCIVQQSDNLQQILVIGHIWIIDLFNKWANVSRAHMSSSWLTNVRRP*(+) MANDKDLLQVVRLLDDACREAGFFYVKGHGIAESLMKEVRDVTHKFFQLPYEEKLKIKMTPQNG YRGYQRLGENITNGKPDMQEAIDYYAPIEPGKYGDLAKPMEGTNLWPKYPSNFDALLKNYISLL RDLSRKIMQGIALALGGPVDAFEGRTAGDPFWVCRLIGYPVSTDILEEHRTDTGCGAHTDYGLL TLVNQDDDICALETLAHLLKRSMIQIWPMTRICCKLSDCWTMHVGRLDSFM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |