Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0248900_circ_g.4 |
| ID in PlantcircBase | osa_circ_038544 |
| Alias | Os_ciR1838 |
| Organism | Oryza sativa |
| Position | chr9: 3726364-3728751 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0248900 |
| Parent gene annotation |
Myb/SANT-like domain domain containing protein. (Os09t0248900-01 ) |
| Parent gene strand | - |
| Alternative splicing | Os09g0248900_circ_g.1 Os09g0248900_circ_g.2 Os09g0248900_circ_g.3 Os09g0248900_circ_g.5 Os09g0248900_circ_g.6 |
| Support reads | 7 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0248900-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.10816607 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3728459-3726580(+) 3728715-3728637(-) |
| Potential amino acid sequence |
MAFHIKESSLPTCIVQQSDNLQQILVIGHIWIIDLFNKWANVSRAHMSSSWLTNVRRP*(+) MANDKDLLQVVRLLDDACREAGFFYVKGHGIAESLMKEVRDVTHKFFQLPYEEKLKIKMTPQNG YRGYQRLGENITNGKPDMQEAIDYYAPIEPGKYGDLAKPMEGTNLWPKYPSNFDALLKNYISLL RDLSRKIMQGIALALGGPVDAFEGRTAGDPFWVCRLIGYPVSTDILEEHRTDTGCGAHTDYGLL TLVNQDDDICALETLAHLLKRSMIQIWPMTRICCKLSDCWTMHVGRLDSFM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |