Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0238100_circ_g.6 |
ID in PlantcircBase | osa_circ_010940 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 7640533-7640807 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0238100 |
Parent gene annotation |
Exocyst complex component Sec10 family protein. (Os12t0238100-01 );Similar to Exocyst complex component 5. (Os12t0238100-02) |
Parent gene strand | - |
Alternative splicing | Os12g0238100_circ_g.3 Os12g0238100_circ_g.4 Os12g0238100_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0238100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.312548667 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7640573-7640606(-) |
Potential amino acid sequence |
MSTMAECAKILSQVHLPRRMLVDMVYHQLLVLLMQVVVWRLLLQIFKSIVMNWRIDC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |