Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0346400_circ_g.4 |
ID in PlantcircBase | osa_circ_038900 |
Alias | Os_ciR5034 |
Organism | Oryza sativa |
Position | chr9: 10839626-10839995 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0346400 |
Parent gene annotation |
Conserved hypothetical protein. (Os09t0346400-01);Hypothetical c onserved gene. (Os09t0346400-02) |
Parent gene strand | + |
Alternative splicing | Os09g0346400_circ_g.5 Os09g0346400_circ_g.6 Os09g0346400_circ_g.7 Os09g0346400_circ_g.8 Os09g0346400_circ_g.9 |
Support reads | 4/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0346400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.217927928 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10839631-10839652(+) 10839633-10839890(-) |
Potential amino acid sequence |
MGMEVVGTEAAPAEVKVTDGEVNLFQENESKATAKEREEAVLFGSDNSTATANGAANGADLAPP KDAEEDWPEARKTHSFFFVKIRLLEDPKLKMKIDQAEKDFQKKIQARSQIFEAIKAKKGHGNGG CWN*(+) MSLLGFYSLKNLRTSLNLLLEVLFCLINLHFQLRVLK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |