Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0346400_circ_g.4 |
| ID in PlantcircBase | osa_circ_038900 |
| Alias | Os_ciR5034 |
| Organism | Oryza sativa |
| Position | chr9: 10839626-10839995 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0346400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os09t0346400-01);Hypothetical c onserved gene. (Os09t0346400-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0346400_circ_g.5 Os09g0346400_circ_g.6 Os09g0346400_circ_g.7 Os09g0346400_circ_g.8 Os09g0346400_circ_g.9 |
| Support reads | 4/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0346400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217927928 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10839631-10839652(+) 10839633-10839890(-) |
| Potential amino acid sequence |
MGMEVVGTEAAPAEVKVTDGEVNLFQENESKATAKEREEAVLFGSDNSTATANGAANGADLAPP KDAEEDWPEARKTHSFFFVKIRLLEDPKLKMKIDQAEKDFQKKIQARSQIFEAIKAKKGHGNGG CWN*(+) MSLLGFYSLKNLRTSLNLLLEVLFCLINLHFQLRVLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |