Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0139900_circ_g.1 |
ID in PlantcircBase | osa_circ_029610 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 2092342-2093116 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os06g0139900 |
Parent gene annotation |
Similar to Beta 1 subunit of 20S proteasome. (Os06t0139900-01) |
Parent gene strand | - |
Alternative splicing | Os06g0139900_circ_g.2 Os06g0139900_circ_g.3 |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0139900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.183478355 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2092910-2093068(-) 2092396-2093068(-) |
Potential amino acid sequence |
MLQAGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEEAENSA WATSYCESCSQLN*(-) MDCLTMNGRRACPRKKLRIQLGQPATVKVAANLIRLLAYQNKNMLQAGMIVGGWDKYEGGQIFS VPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEEAENSAWATSYCESCSQLN*(-) |
Sponge-miRNAs | osa-miR5083 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |