Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0139900_circ_g.2 |
| ID in PlantcircBase | osa_circ_029611 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 2092342-2093763 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0139900 |
| Parent gene annotation |
Similar to Beta 1 subunit of 20S proteasome. (Os06t0139900-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0139900_circ_g.1 Os06g0139900_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0139900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016335 |
| PMCS | 0.13978498 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2093741-2092845(+) 2092396-2093738(-) 2093763-2093721(-) |
| Potential amino acid sequence |
MHGSPHTFLSFFLGHALLPFMVKQSIQVTGTRTSNCKWLPQNCSTKGD*(+) MDCLTMNGRRACPRKKLRNVCGEPCI*(-) MYVANRASDKITQLTDNVYVCRSGSAADTQVISEYVRYFLHQHTIQLGQPATVKVAANLIRLLA YQNKNMLQAGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEE AEECMWRTVHLTKLLN*(-) |
| Sponge-miRNAs | osa-miR5083 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |