Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G08830_circ_g.7 |
| ID in PlantcircBase | ath_circ_001468 |
| Alias | At_ciR4134 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 2828106-2828581 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, MapSplice, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G08830 |
| Parent gene annotation |
Superoxide dismutase |
| Parent gene strand | + |
| Alternative splicing | AT1G08830_circ_g.1 AT1G08830_circ_g.2 AT1G08830_circ_g.3 AT1G08830_circ_g.4 AT1G08830_circ_g.5 AT1G08830_circ_g.6 AT1G08830_circ_g.8 AT1G08830_circ_g.9 AT1G08830_circ_g.10 |
| Support reads | 4/2 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G08830.1:3 AT1G08830.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202330883 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2828185-2828108(-) |
| Potential amino acid sequence |
MFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSVIVKVAVPS SPTVMFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSVIVKV AVPSSPTVMFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSV IVKVAVPSSPTVMFPRSPACRLASSGAPCVLPSGLKCG(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Liu et al., 2017 |