Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G08830_circ_g.7 |
ID in PlantcircBase | ath_circ_001468 |
Alias | At_ciR4134 |
Organism | Arabidpsis thaliana |
Position | chr1: 2828106-2828581 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, MapSplice, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT1G08830 |
Parent gene annotation |
Superoxide dismutase |
Parent gene strand | + |
Alternative splicing | AT1G08830_circ_g.1 AT1G08830_circ_g.2 AT1G08830_circ_g.3 AT1G08830_circ_g.4 AT1G08830_circ_g.5 AT1G08830_circ_g.6 AT1G08830_circ_g.8 AT1G08830_circ_g.9 AT1G08830_circ_g.10 |
Support reads | 4/2 |
Tissues | leaf/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G08830.1:3 AT1G08830.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.202330883 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2828185-2828108(-) |
Potential amino acid sequence |
MFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSVIVKVAVPS SPTVMFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSVIVKV AVPSSPTVMFPRSPACRLASSGAPCVLPSGLKCGPFPRSSGSAWTTTALPTIEFGPVRGIWQSV IVKVAVPSSPTVMFPRSPACRLASSGAPCVLPSGLKCG(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Liu et al., 2017 |